PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12792A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family Nin-like
Protein Properties Length: 279aa    MW: 29707.4 Da    PI: 8.9085
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12792AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK70.81.9e-221763450
                     RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50
                                +s e++sk Fslpi++AA+ Lgvc+ vLKriCR +GI RWP+Rk+ 
  Oropetium_20150105_12792A 17 ALSYEEISKLFSLPIAEAASILGVCTNVLKRICRTHGIVRWPYRKLV 63
                               5899*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.642185IPR003035RWP-RK domain
PfamPF020423.5E-201863IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MASNASAQPK PKPTRVALSY EEISKLFSLP IAEAASILGV CTNVLKRICR THGIVRWPYR  60
KLVSGKAGDD SKNSEREKAK ELLELSKAGK QKPFSSSGPS AMSSSSSQAA AKSQHGVSKT  120
GQISPPGKQN ASSGLALVSQ TRGIPTFMDE FKHGFPSSGL SCETLKWWGE SSHLDSAAPA  180
KDVNHEPETH DASKGMTDDE LDWGADEEGE ADGTVTAAEP SAQLCSLRRK AVDDGRKLLN  240
GDAYRGQQVF SRLNKRQKLV LAQVFGASLP VELNSVVV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140342.11e-129uncharacterized protein LOC100272390
TrEMBLA0A0A9PF781e-136A0A0A9PF78_ARUDO; Uncharacterized protein
STRINGAC233880.1_FGP0061e-128(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67053242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.13e-10RWP-RK domain-containing protein